(data stored in ACNUC30630 zone)

EMBL: AP009044.PE349

AP009044.PE349       Location/Qualifiers
FT   CDS             373995..374339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53297"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ0"
FT                   /protein_id="BAF53297.1"
FT                   /translation="MRAYPPMVDRPSFDFEAIERKLARQQIRNSQGHCSGTNGGGAESN
FT                   GKETSGALNCSFDLRSLSSRQEAQQIGDFLWKLDPRAEVGGTSSRASFLCASDSSATSQ
FT                   GGGSDCNCCD"
     MRAYPPMVDR PSFDFEAIER KLARQQIRNS QGHCSGTNGG GAESNGKETS GALNCSFDLR        60
     SLSSRQEAQQ IGDFLWKLDP RAEVGGTSSR ASFLCASDSS ATSQGGGSDC NCCD             114
//

If you have problems or comments...

PBIL Back to PBIL home page