(data stored in ACNUC30630 zone)

EMBL: AP009044.PE401

AP009044.PE401       Location/Qualifiers
FT   CDS             complement(417049..418044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53347"
FT                   /db_xref="GOA:A4QAV0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV0"
FT                   /protein_id="BAF53347.1"
FT                   /translation="MAFFSFSTSPLTRLIPGSRSKATGAKRRLNSTIASIERSPGIIAL
FT                   DGPFTHDHVSVRGIRLHLAEAGSPTKPLVLLIHGAFGGWYDYREVIGPLADAGFHVAAI
FT                   DLRGYGMSDKPPTGYDLRHAAGELSSVIAALGHDDAFLVGSDTGASIAWAIASMYPERV
FT                   RGLISLGAIHPLDMRRAIRRKPHLHVSDLSRLAPFRLPSFLHNLFQFGITRAARREIVN
FT                   NTSSSYQRSNAFTEAVLLRKKALSIDHTITPIIRTNRYLVGSIPSKTVSAPVWLLRTNS
FT                   RRWEHLANTARTRTTGPFTTIAIPGGYELPYLENPSEFAATIAEFARTTF"
     MAFFSFSTSP LTRLIPGSRS KATGAKRRLN STIASIERSP GIIALDGPFT HDHVSVRGIR        60
     LHLAEAGSPT KPLVLLIHGA FGGWYDYREV IGPLADAGFH VAAIDLRGYG MSDKPPTGYD       120
     LRHAAGELSS VIAALGHDDA FLVGSDTGAS IAWAIASMYP ERVRGLISLG AIHPLDMRRA       180
     IRRKPHLHVS DLSRLAPFRL PSFLHNLFQF GITRAARREI VNNTSSSYQR SNAFTEAVLL       240
     RKKALSIDHT ITPIIRTNRY LVGSIPSKTV SAPVWLLRTN SRRWEHLANT ARTRTTGPFT       300
     TIAIPGGYEL PYLENPSEFA ATIAEFARTT F                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page