(data stored in ACNUC30630 zone)

EMBL: AP009044.PE404

AP009044.PE404       Location/Qualifiers
FT   CDS             420097..421158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53350"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV3"
FT                   /protein_id="BAF53350.1"
FT                   /translation="MNTTTHQAILIAVEDPVLHPEAMHVAAATGRPVIETTNLMDISRH
FT                   FHRASAVLIDTSMASQLSPGKRRDRVFLLDSDPGPSDWKTAMKIHAEQAMLLPAQAGEL
FT                   LSALGRDDKQLPVASGHVIGVAGVVGGTGASTFAAALAKRRAESATTVLIDADPSSGGI
FT                   DLLLGIEDVPGARWPDVGLRRGTVQAADVLKALPSTPDEVVVLSTARSNVLDPFALSES
FT                   DVSAAIDCFLSADRSVDVVVDLPHARVHPDIAERLSHLVLVIPAEVRAVAAARARYMEL
FT                   QQLHVSITCVLRHRGWSGLDVAEVEEILGADITAEVGSIQRLAKSVEMHGLTGSLPRVL
FT                   SSACDAVIGEVAA"
     MNTTTHQAIL IAVEDPVLHP EAMHVAAATG RPVIETTNLM DISRHFHRAS AVLIDTSMAS        60
     QLSPGKRRDR VFLLDSDPGP SDWKTAMKIH AEQAMLLPAQ AGELLSALGR DDKQLPVASG       120
     HVIGVAGVVG GTGASTFAAA LAKRRAESAT TVLIDADPSS GGIDLLLGIE DVPGARWPDV       180
     GLRRGTVQAA DVLKALPSTP DEVVVLSTAR SNVLDPFALS ESDVSAAIDC FLSADRSVDV       240
     VVDLPHARVH PDIAERLSHL VLVIPAEVRA VAAARARYME LQQLHVSITC VLRHRGWSGL       300
     DVAEVEEILG ADITAEVGSI QRLAKSVEMH GLTGSLPRVL SSACDAVIGE VAA              353
//

If you have problems or comments...

PBIL Back to PBIL home page