(data stored in ACNUC30630 zone)

EMBL: AP009044.PE409

AP009044.PE409       Location/Qualifiers
FT   CDS             423849..424169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53355"
FT                   /db_xref="GOA:A4QAV8"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV8"
FT                   /protein_id="BAF53355.1"
FT                   /translation="MRTKQQREPPELCSDDGSVSIEAALALSSLVIVCGLIIAAMATLA
FT                   AYLAAVDAAGAAARAHAIGESFEPARGHVDMHEAGGMLTATATIPAPIGQVSASAVFPV
FT                   EN"
     MRTKQQREPP ELCSDDGSVS IEAALALSSL VIVCGLIIAA MATLAAYLAA VDAAGAAARA        60
     HAIGESFEPA RGHVDMHEAG GMLTATATIP APIGQVSASA VFPVEN                      106
//

If you have problems or comments...

PBIL Back to PBIL home page