(data stored in ACNUC30630 zone)

EMBL: AP009044.PE415

AP009044.PE415       Location/Qualifiers
FT   CDS             complement(431833..433338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53361"
FT                   /db_xref="GOA:A4QAW4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW4"
FT                   /protein_id="BAF53361.1"
FT                   /translation="MKWLWGTSWPLYAATVLGTNVFGALAVMLFVRFLIPQPDASNFNA
FT                   EISYLPAVGFAYLAFAIVAGMLVTFLMFRPVLDWQRSPEDHDRNMVRNLVMRIPIYQAI
FT                   LCAVVWLIGIAIATLISASVSTSLALVVAFSTLMAAAIVVLLTFLEAERLVRPVAASAL
FT                   ARRFEDSTLEPPVSQRLRMTWLLTLGIPVMGILLLIWGYSQGIFGSDASGIMPAIAALA
FT                   FASLVTGYLGNRLVVSSVVDPIRELQEAINRVRRGENDVQVDIYDGSEIGVLQAGFNEM
FT                   MRGLRERQRVRDLFGRYVGAEVAKRALEERPTLGGEDRKVAVLFVDVIGSTTFAVNHTP
FT                   EEVVEALNEFFEHVVEVVHRNKGVINKFQGDAALAIFGAPLPLSDATGHALAAARELRA
FT                   ELKDLQLKAGIGVAAGHVVAGHIGGHARFEYTVIGDAVNQAARLTEIAKTTPGRTVTNA
FT                   STLREANEAEQARWTLMKSVELRGRGQMTQIARPIRPTLADRS"
     MKWLWGTSWP LYAATVLGTN VFGALAVMLF VRFLIPQPDA SNFNAEISYL PAVGFAYLAF        60
     AIVAGMLVTF LMFRPVLDWQ RSPEDHDRNM VRNLVMRIPI YQAILCAVVW LIGIAIATLI       120
     SASVSTSLAL VVAFSTLMAA AIVVLLTFLE AERLVRPVAA SALARRFEDS TLEPPVSQRL       180
     RMTWLLTLGI PVMGILLLIW GYSQGIFGSD ASGIMPAIAA LAFASLVTGY LGNRLVVSSV       240
     VDPIRELQEA INRVRRGEND VQVDIYDGSE IGVLQAGFNE MMRGLRERQR VRDLFGRYVG       300
     AEVAKRALEE RPTLGGEDRK VAVLFVDVIG STTFAVNHTP EEVVEALNEF FEHVVEVVHR       360
     NKGVINKFQG DAALAIFGAP LPLSDATGHA LAAARELRAE LKDLQLKAGI GVAAGHVVAG       420
     HIGGHARFEY TVIGDAVNQA ARLTEIAKTT PGRTVTNAST LREANEAEQA RWTLMKSVEL       480
     RGRGQMTQIA RPIRPTLADR S                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page