(data stored in ACNUC30630 zone)

EMBL: AP009044.PE42

AP009044.PE42        Location/Qualifiers
FT   CDS             complement(49547..50398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53003"
FT                   /db_xref="GOA:A4Q9W0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W0"
FT                   /protein_id="BAF53003.1"
FT                   /translation="MKFFIDALIVPFDVSFISRALVAGCLAAILCSLIGTWVTLRRLTF
FT                   FGDAMSHGMLPGVATASLLGGNLMFGAAISALIMSAGVVWTSRKSSLSQDVSIGLQFIT
FT                   MLSLGVVIVSHSDSHAVDLTSFLFGDILGVRPSDIFIIAIATVLGGLTIFLFHRQFTAL
FT                   AFDERKAHTLGLNPRFTHLLMLALIALATVVSFQVVGTLLVFGLLISPPATAALLVQDK
FT                   ASISLIMIVASLLGCAEIYLGLLISWHASTAAGATITLLSAAIFFATLLTKSAISGLNF
FT                   TA"
     MKFFIDALIV PFDVSFISRA LVAGCLAAIL CSLIGTWVTL RRLTFFGDAM SHGMLPGVAT        60
     ASLLGGNLMF GAAISALIMS AGVVWTSRKS SLSQDVSIGL QFITMLSLGV VIVSHSDSHA       120
     VDLTSFLFGD ILGVRPSDIF IIAIATVLGG LTIFLFHRQF TALAFDERKA HTLGLNPRFT       180
     HLLMLALIAL ATVVSFQVVG TLLVFGLLIS PPATAALLVQ DKASISLIMI VASLLGCAEI       240
     YLGLLISWHA STAAGATITL LSAAIFFATL LTKSAISGLN FTA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page