(data stored in ACNUC30630 zone)

EMBL: AP009044.PE424

AP009044.PE424       Location/Qualifiers
FT   CDS             442267..443499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53370"
FT                   /db_xref="GOA:A4QAX3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX3"
FT                   /protein_id="BAF53370.1"
FT                   /translation="MGVSAFNISDMVANKRAQRKVWLAVALSVFTVAWGGNEFTPLLVF
FT                   YRGEGFFSNLFIDLLLVFYAIGVAVGLLAAGPLSDRYGRRAVMLPAPLIAILGSALIAL
FT                   GEETAILIAIGRVLSGISVGMVMTVGGSWIKELSSSRFEPGVKTSAGAKRASMSLTGGF
FT                   ALGPALAGVMAQWLPLPGQLAYVLHIILTLILFPLLITAPETRQSAHLKTKGSFWSDVL
FT                   VPSALDKRFLFVVAPIGPWVFGAAFTAYAVLPSQLRDMVSAPVAYSALIALVTLGSGFG
FT                   IQQFGPQIMGTSKTRGPILAMFVTVIGMIGAVIVVMNPHPWWALVVCMALGLSYGLCMF
FT                   MGLAETQNIAPPVDMAGLTGIFYCLTYVGMVFPALMTWLNQWLSYPFMLGFGAVMATIC
FT                   LIIVSFSARRF"
     MGVSAFNISD MVANKRAQRK VWLAVALSVF TVAWGGNEFT PLLVFYRGEG FFSNLFIDLL        60
     LVFYAIGVAV GLLAAGPLSD RYGRRAVMLP APLIAILGSA LIALGEETAI LIAIGRVLSG       120
     ISVGMVMTVG GSWIKELSSS RFEPGVKTSA GAKRASMSLT GGFALGPALA GVMAQWLPLP       180
     GQLAYVLHII LTLILFPLLI TAPETRQSAH LKTKGSFWSD VLVPSALDKR FLFVVAPIGP       240
     WVFGAAFTAY AVLPSQLRDM VSAPVAYSAL IALVTLGSGF GIQQFGPQIM GTSKTRGPIL       300
     AMFVTVIGMI GAVIVVMNPH PWWALVVCMA LGLSYGLCMF MGLAETQNIA PPVDMAGLTG       360
     IFYCLTYVGM VFPALMTWLN QWLSYPFMLG FGAVMATICL IIVSFSARRF                  410
//

If you have problems or comments...

PBIL Back to PBIL home page