(data stored in ACNUC30630 zone)

EMBL: AP009044.PE426

AP009044.PE426       Location/Qualifiers
FT   CDS             complement(444908..445285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53372"
FT                   /db_xref="GOA:A4QAX5"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX5"
FT                   /protein_id="BAF53372.1"
FT                   /translation="MTQTTTQIIIQILLLLATAALALYFLRNRRKARAKAWVKIGFVVF
FT                   IFAAVWAVIRPDDLTQLANFVGVDRGTDLMLYALVVAFMFTTLSSYVRFREQELRCSKL
FT                   ARAVALQNVVLPEDSQDSDPA"
     MTQTTTQIII QILLLLATAA LALYFLRNRR KARAKAWVKI GFVVFIFAAV WAVIRPDDLT        60
     QLANFVGVDR GTDLMLYALV VAFMFTTLSS YVRFREQELR CSKLARAVAL QNVVLPEDSQ       120
     DSDPA                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page