(data stored in ACNUC30630 zone)

EMBL: AP009044.PE427

AP009044.PE427       Location/Qualifiers
FT   CDS             complement(445282..446118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53373"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX6"
FT                   /protein_id="BAF53373.1"
FT                   /translation="MRDCVPASCSRSMDFMTIKLSSLGSVAPNRKIGHHALGSIPIMDA
FT                   SKNSDFKDTWLVVPCYNEATVIREVLENALKTFPNIVAVNDGSPDNSAEEIHAAGAHLV
FT                   NHPVNLGQGAAIQTGIEYARKQPGAKYFVTFDADGQHQVKDVVRMVERLRAEDVDIIVG
FT                   TRFGRPRQADDQVPLIKRLVLRTVVLLSPKTRRLGLTDAHNGLRVFNQKVAQEMNIRMN
FT                   GMSHASEIVDQIDERGWRISEEPVDILYTEYSMSKGQSLLNGVNILADGFLARRLP"
     MRDCVPASCS RSMDFMTIKL SSLGSVAPNR KIGHHALGSI PIMDASKNSD FKDTWLVVPC        60
     YNEATVIREV LENALKTFPN IVAVNDGSPD NSAEEIHAAG AHLVNHPVNL GQGAAIQTGI       120
     EYARKQPGAK YFVTFDADGQ HQVKDVVRMV ERLRAEDVDI IVGTRFGRPR QADDQVPLIK       180
     RLVLRTVVLL SPKTRRLGLT DAHNGLRVFN QKVAQEMNIR MNGMSHASEI VDQIDERGWR       240
     ISEEPVDILY TEYSMSKGQS LLNGVNILAD GFLARRLP                               278
//

If you have problems or comments...

PBIL Back to PBIL home page