(data stored in ACNUC30630 zone)

EMBL: AP009044.PE429

AP009044.PE429       Location/Qualifiers
FT   CDS             447133..448170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53375"
FT                   /db_xref="GOA:A4QAX8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX8"
FT                   /protein_id="BAF53375.1"
FT                   /translation="MSNKRIGVVIVSYGHEQDVANLVDTFADQLKTGDRVVVVDNRKPW
FT                   VLKDAVGERLEKHGAEIINHDNGGFAAGCNVGAAHIVDDVDLLFFLNPDTVIDDPTLFN
FT                   SLRRVDEQWAAFMPYLLLPDGTINSAGNALHISGLSWVTGLDEKPVEGSSEVTDISIAS
FT                   GACLAVRVDWWKRLGGMEELYFMYHEDTDFSARLLLAGGRIGLLHSAYVTHHYDYAKGD
FT                   YKWIYIERNRHVLLLSVLPLPLLFVLIPQILGVNLGLWAIAAKEKRVGLKMKSLRLLIR
FT                   DLPAIFKLRRSTQELAELTPSQYLAKMEWRLDNPNLGNIGSNKIVATGYKTYYKLCMSI
FT                   LKLLA"
     MSNKRIGVVI VSYGHEQDVA NLVDTFADQL KTGDRVVVVD NRKPWVLKDA VGERLEKHGA        60
     EIINHDNGGF AAGCNVGAAH IVDDVDLLFF LNPDTVIDDP TLFNSLRRVD EQWAAFMPYL       120
     LLPDGTINSA GNALHISGLS WVTGLDEKPV EGSSEVTDIS IASGACLAVR VDWWKRLGGM       180
     EELYFMYHED TDFSARLLLA GGRIGLLHSA YVTHHYDYAK GDYKWIYIER NRHVLLLSVL       240
     PLPLLFVLIP QILGVNLGLW AIAAKEKRVG LKMKSLRLLI RDLPAIFKLR RSTQELAELT       300
     PSQYLAKMEW RLDNPNLGNI GSNKIVATGY KTYYKLCMSI LKLLA                       345
//

If you have problems or comments...

PBIL Back to PBIL home page