(data stored in ACNUC30630 zone)

EMBL: AP009044.PE437

AP009044.PE437       Location/Qualifiers
FT   CDS             457571..458518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53383"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY6"
FT                   /protein_id="BAF53383.1"
FT                   /translation="MHFCLLSLARPAKVVAPLLGAALLLSSCSSTSSDEPIQPEVASTG
FT                   YSVEHAMGTTEIPETPKRVVVIDSPHLDALLALGITPVGATESGSENGFPTYLADELKD
FT                   TESVGLTSEPNLEKIAALDPDLIIGAKVRHEAIYDQLSDIAPTVMSEGSGTNWNEQAEI
FT                   TAAAVNKSDEMDKLIADLDTRAKDLGEEIGAEGQTASMVRFRPDNFRLYGPETFSGSVL
FT                   EQVGFDLGERDWNEYSMMELSPENFGQIDGDLIFYTIPGSPEATTYPQVSELWVDSPAV
FT                   QQGKTYEFEDETWMVGIGVLGANEILDDLEETLS"
     MHFCLLSLAR PAKVVAPLLG AALLLSSCSS TSSDEPIQPE VASTGYSVEH AMGTTEIPET        60
     PKRVVVIDSP HLDALLALGI TPVGATESGS ENGFPTYLAD ELKDTESVGL TSEPNLEKIA       120
     ALDPDLIIGA KVRHEAIYDQ LSDIAPTVMS EGSGTNWNEQ AEITAAAVNK SDEMDKLIAD       180
     LDTRAKDLGE EIGAEGQTAS MVRFRPDNFR LYGPETFSGS VLEQVGFDLG ERDWNEYSMM       240
     ELSPENFGQI DGDLIFYTIP GSPEATTYPQ VSELWVDSPA VQQGKTYEFE DETWMVGIGV       300
     LGANEILDDL EETLS                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page