(data stored in ACNUC30630 zone)

EMBL: AP009044.PE442

AP009044.PE442       Location/Qualifiers
FT   CDS             complement(464210..464623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53388"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ1"
FT                   /protein_id="BAF53388.1"
FT                   /translation="MAHAELSFGSSSFGSSGLSATRDKKAVEFENALEEFFITTGRTKT
FT                   DNAEAIADDYYQRAVNGELEFMEDMFFTDYIESERLYVVANSIPPERIDDEIAIIKQNT
FT                   SFLNPDGEKDTGAIGVRVDFENGHYYSVQVYVG"
     MAHAELSFGS SSFGSSGLSA TRDKKAVEFE NALEEFFITT GRTKTDNAEA IADDYYQRAV        60
     NGELEFMEDM FFTDYIESER LYVVANSIPP ERIDDEIAII KQNTSFLNPD GEKDTGAIGV       120
     RVDFENGHYY SVQVYVG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page