(data stored in ACNUC30630 zone)

EMBL: AP009044.PE446

AP009044.PE446       Location/Qualifiers
FT   CDS             complement(466641..466745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53392"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ5"
FT                   /protein_id="BAF53392.1"
FT                   /translation="MADFGVSVAQEGDLYYVAIVQKETSGGTGPIIGG"
     MADFGVSVAQ EGDLYYVAIV QKETSGGTGP IIGG                                    34
//

If you have problems or comments...

PBIL Back to PBIL home page