(data stored in ACNUC30630 zone)

EMBL: AP009044.PE448

AP009044.PE448       Location/Qualifiers
FT   CDS             complement(467311..467787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53394"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ7"
FT                   /protein_id="BAF53394.1"
FT                   /translation="MKVSNKRLISTALSLSIIFAGTQGIAHAQSSFVSGSSSVETNINR
FT                   DAKSLRYTELYKKVFLALGHELNPLAQAKADDLLQRALRGELVFENGSYVEQNSPGIHY
FT                   ASVDQISSDDLDFELSLLEIVYADLEIYPNEDLIQIGVASGKDRQYYYIVHVAL"
     MKVSNKRLIS TALSLSIIFA GTQGIAHAQS SFVSGSSSVE TNINRDAKSL RYTELYKKVF        60
     LALGHELNPL AQAKADDLLQ RALRGELVFE NGSYVEQNSP GIHYASVDQI SSDDLDFELS       120
     LLEIVYADLE IYPNEDLIQI GVASGKDRQY YYIVHVAL                               158
//

If you have problems or comments...

PBIL Back to PBIL home page