(data stored in ACNUC30630 zone)

EMBL: AP009044.PE459

AP009044.PE459       Location/Qualifiers
FT   CDS             482091..483905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6021"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21083"
FT                   /db_xref="GOA:A0A0B6VK13"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VK13"
FT                   /protein_id="BAQ21083.1"
FT                   /translation="MSYLAPVLSRGFVQTANASEAVVHSTTNHVAPSRGRYQVVSVQGF
FT                   ASLFGVPFTSADELALILNGRIDSPEQLVKELRGTATITLRETDTGAFYVITDMYGAGK
FT                   IFIWQDSVRWAVSSSVKDLVSFLNQNGIKAKKSIENAGLLGFVGYGGGAISSPYEDILC
FT                   VDQFKYVIVAANGKLNQRDYSFKEELVGPSAPNSSNQEDLLQSVAIEIRRNTSVFSSYK
FT                   AESYICHLTGGLDSRVVFAALVGTPYKDQYSTFTYGLEESPDMVIARRLTAEFGLTAST
FT                   YSGMRYSVVPQDPALQVLWSLNQTGGMTSLGPASIGGYPRPDSVVLAGGWGEMYRGGYP
FT                   DFVSADASHEEKIKWVVNWVLRSGSPYGPRISYDGLFSDAMVQRARDFGQLMLSEIQHL
FT                   EIGDELLAEWMYLRWSTRFNVGEITRTCLPFTHRADPLCVPEMMKLVYATPFSDRKNGN
FT                   LELDLVKALYPGMESYPYDKDYLTEDYLRTRGISDVASFDESLPLEIKWHFDDKPHYLE
FT                   AITPVARPTQAQKAEALRVKMPLRFIVRAEENRRRIQNYVRDVPEEMSQVFNLKNLKNV
FT                   TDRNPKTRPEYRRLETLNSALSWYFEQE"
     MSYLAPVLSR GFVQTANASE AVVHSTTNHV APSRGRYQVV SVQGFASLFG VPFTSADELA        60
     LILNGRIDSP EQLVKELRGT ATITLRETDT GAFYVITDMY GAGKIFIWQD SVRWAVSSSV       120
     KDLVSFLNQN GIKAKKSIEN AGLLGFVGYG GGAISSPYED ILCVDQFKYV IVAANGKLNQ       180
     RDYSFKEELV GPSAPNSSNQ EDLLQSVAIE IRRNTSVFSS YKAESYICHL TGGLDSRVVF       240
     AALVGTPYKD QYSTFTYGLE ESPDMVIARR LTAEFGLTAS TYSGMRYSVV PQDPALQVLW       300
     SLNQTGGMTS LGPASIGGYP RPDSVVLAGG WGEMYRGGYP DFVSADASHE EKIKWVVNWV       360
     LRSGSPYGPR ISYDGLFSDA MVQRARDFGQ LMLSEIQHLE IGDELLAEWM YLRWSTRFNV       420
     GEITRTCLPF THRADPLCVP EMMKLVYATP FSDRKNGNLE LDLVKALYPG MESYPYDKDY       480
     LTEDYLRTRG ISDVASFDES LPLEIKWHFD DKPHYLEAIT PVARPTQAQK AEALRVKMPL       540
     RFIVRAEENR RRIQNYVRDV PEEMSQVFNL KNLKNVTDRN PKTRPEYRRL ETLNSALSWY       600
     FEQE                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page