(data stored in ACNUC30630 zone)

EMBL: AP009044.PE461

AP009044.PE461       Location/Qualifiers
FT   CDS             complement(488902..490158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53401"
FT                   /db_xref="GOA:A4QB04"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB04"
FT                   /protein_id="BAF53401.1"
FT                   /translation="MTNQTVAFVGLGYIGLPTAVVMANSGVDVTGVDVNEKNVERINRG
FT                   EVTIVEPGLEEELKQAIESGNFRATTTQVHAQTYIIAVPTPFTDDYGVDMKYIYSAAEA
FT                   IAPKLEGNELVILESTSPPLTTKKMADKILELRPDLVADGAENPEGKPVIYFAHCPERI
FT                   LPGKAMEELRTNDRIIGGQTEEATKRATAVYATFCEAELLPTNDVTAEMAKLTENSFRD
FT                   VNIAFANELSLIADNLDINVWELIELANHHPRVNILQPGPGVGGHCIAVDPWFIVSSDP
FT                   QNSRLIRTAREVNDGKPKWVIDKVAEALNGYQTGAKIATLGMAFKADIDDLRESPALNI
FT                   TKELANRFVDQTILAVEPNVSKLPTDLEGIKNITLTAYDQAIADADIVVLLVDHHEFKG
FT                   VSAAQLKDKTIIDTKGLWV"
     MTNQTVAFVG LGYIGLPTAV VMANSGVDVT GVDVNEKNVE RINRGEVTIV EPGLEEELKQ        60
     AIESGNFRAT TTQVHAQTYI IAVPTPFTDD YGVDMKYIYS AAEAIAPKLE GNELVILEST       120
     SPPLTTKKMA DKILELRPDL VADGAENPEG KPVIYFAHCP ERILPGKAME ELRTNDRIIG       180
     GQTEEATKRA TAVYATFCEA ELLPTNDVTA EMAKLTENSF RDVNIAFANE LSLIADNLDI       240
     NVWELIELAN HHPRVNILQP GPGVGGHCIA VDPWFIVSSD PQNSRLIRTA REVNDGKPKW       300
     VIDKVAEALN GYQTGAKIAT LGMAFKADID DLRESPALNI TKELANRFVD QTILAVEPNV       360
     SKLPTDLEGI KNITLTAYDQ AIADADIVVL LVDHHEFKGV SAAQLKDKTI IDTKGLWV         418
//

If you have problems or comments...

PBIL Back to PBIL home page