(data stored in ACNUC30630 zone)

EMBL: AP009044.PE468

AP009044.PE468       Location/Qualifiers
FT   CDS             496736..498757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53408"
FT                   /db_xref="GOA:A4QB11"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB11"
FT                   /protein_id="BAF53408.1"
FT                   /translation="MSTHSETTRPEFIHPVSVLPEVSAGTVLDAAEPAGVPTKDMWEYQ
FT                   KDHMNLVSPLNRRKFRVLVVGTGLSGGAAAAALGELGYDVKAFTYHDAPRRAHSIAAQG
FT                   GVNSARGKKVDNDGAYRHVKDTVKGGDYRGRESDCWRLAVESVRVIDHMNAIGAPFARE
FT                   YGGALATRSFGGVQVSRTYYTRGQTGQQLQLSTASALQRQIHLGSVEIFTHNEMVDVIV
FT                   TERNGEKRCEGLIMRNLITGELTAHTGHAVILATGGYGNVYHMSTLAKNSNASAIMRAY
FT                   EAGAYFASPSFIQFHPTGLPVNSTWQSKTILMSESLRNDGRIWSPKEPNDNRDPNTIPE
FT                   DERDYFLERRYPAFGNLVPRDVASRAISQQINAGLGVGPLNNAAYLDFRDATERLGQDT
FT                   IRERYSNLFTMYEEAIGEDPYSSPMRIAPTCHFTMGGLWTDFNEMTSLPGLFCAGEASW
FT                   TYHGANRLGANSLLSASVDGWFTLPFTVPNYLGPLLGAERLAEDAPEAQAAIERAQARI
FT                   DRLMGNRPEWIGDNPHGPEYYHRQLGDILYFSCGVSRNVKDLQDGIDKIRALREDFWKN
FT                   MRITGSTDEMNQVLEYAARVADYIDLGELMCVDALDRDESCGAHFRDDHLSEDGEAERD
FT                   DENWCFVSAWEPGKNGTFVRHAEPLFFESVPLQTRNYK"
     MSTHSETTRP EFIHPVSVLP EVSAGTVLDA AEPAGVPTKD MWEYQKDHMN LVSPLNRRKF        60
     RVLVVGTGLS GGAAAAALGE LGYDVKAFTY HDAPRRAHSI AAQGGVNSAR GKKVDNDGAY       120
     RHVKDTVKGG DYRGRESDCW RLAVESVRVI DHMNAIGAPF AREYGGALAT RSFGGVQVSR       180
     TYYTRGQTGQ QLQLSTASAL QRQIHLGSVE IFTHNEMVDV IVTERNGEKR CEGLIMRNLI       240
     TGELTAHTGH AVILATGGYG NVYHMSTLAK NSNASAIMRA YEAGAYFASP SFIQFHPTGL       300
     PVNSTWQSKT ILMSESLRND GRIWSPKEPN DNRDPNTIPE DERDYFLERR YPAFGNLVPR       360
     DVASRAISQQ INAGLGVGPL NNAAYLDFRD ATERLGQDTI RERYSNLFTM YEEAIGEDPY       420
     SSPMRIAPTC HFTMGGLWTD FNEMTSLPGL FCAGEASWTY HGANRLGANS LLSASVDGWF       480
     TLPFTVPNYL GPLLGAERLA EDAPEAQAAI ERAQARIDRL MGNRPEWIGD NPHGPEYYHR       540
     QLGDILYFSC GVSRNVKDLQ DGIDKIRALR EDFWKNMRIT GSTDEMNQVL EYAARVADYI       600
     DLGELMCVDA LDRDESCGAH FRDDHLSEDG EAERDDENWC FVSAWEPGKN GTFVRHAEPL       660
     FFESVPLQTR NYK                                                          673
//

If you have problems or comments...

PBIL Back to PBIL home page