(data stored in ACNUC30630 zone)

EMBL: AP009044.PE48

AP009044.PE48        Location/Qualifiers
FT   CDS             54774..55346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53009"
FT                   /db_xref="GOA:A4Q9W6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W6"
FT                   /protein_id="BAF53009.1"
FT                   /translation="MGHVVGISLDVVMMGVMTSKTATAILHTNRGDITIDLFGNHAPET
FT                   VANFVGLAQGTKEYQAQNAQGDSEGPFYNGSVFHRVIDGFMIQGGDPTGTGRGGPGYTF
FT                   ADEFHPELRFDRAYLLAMANAGPGTNGSQFFITVTPTPHLNNAHTIFGEVTDAESQKVV
FT                   DAIATTATDRYDRPADAVVIESVEITA"
     MGHVVGISLD VVMMGVMTSK TATAILHTNR GDITIDLFGN HAPETVANFV GLAQGTKEYQ        60
     AQNAQGDSEG PFYNGSVFHR VIDGFMIQGG DPTGTGRGGP GYTFADEFHP ELRFDRAYLL       120
     AMANAGPGTN GSQFFITVTP TPHLNNAHTI FGEVTDAESQ KVVDAIATTA TDRYDRPADA       180
     VVIESVEITA                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page