(data stored in ACNUC30630 zone)

EMBL: AP009044.PE480

AP009044.PE480       Location/Qualifiers
FT   CDS             complement(509773..510687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53420"
FT                   /db_xref="GOA:A4QB23"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB23"
FT                   /protein_id="BAF53420.1"
FT                   /translation="MTPSSPEVRNRPSTAPEERQFVLTFGCPDSTGIVAKLSSFLAERG
FT                   GWITEAGYFTDPDSNWFFTRQAIRAESIDTTIEQLREEFAPLAEEFGPRAKWSFTDTAQ
FT                   VKKAVLLVSKEGHCLHDLLGRVAENDYPMEVVAVVGNHENLRYIAENHNVPFFHVPFPK
FT                   DAVGKRKAFDQVAEIVNGYDPDAIVLARFMQILPPDLCEMWAGRVLNIHHSFLPSFMGA
FT                   RPYHQAYSRGVKLIGATCHYATGDLDDGPIIEQDVIRVTHKDTPTEMQRLGRDAEKQVL
FT                   ARGLRFHLEDRVLVYGNRTVVFD"
     MTPSSPEVRN RPSTAPEERQ FVLTFGCPDS TGIVAKLSSF LAERGGWITE AGYFTDPDSN        60
     WFFTRQAIRA ESIDTTIEQL REEFAPLAEE FGPRAKWSFT DTAQVKKAVL LVSKEGHCLH       120
     DLLGRVAEND YPMEVVAVVG NHENLRYIAE NHNVPFFHVP FPKDAVGKRK AFDQVAEIVN       180
     GYDPDAIVLA RFMQILPPDL CEMWAGRVLN IHHSFLPSFM GARPYHQAYS RGVKLIGATC       240
     HYATGDLDDG PIIEQDVIRV THKDTPTEMQ RLGRDAEKQV LARGLRFHLE DRVLVYGNRT       300
     VVFD                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page