(data stored in ACNUC30630 zone)

EMBL: AP009044.PE486

AP009044.PE486       Location/Qualifiers
FT   CDS             515803..517635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53425"
FT                   /db_xref="InterPro:IPR007331"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB28"
FT                   /protein_id="BAF53425.1"
FT                   /translation="MKLAPRMRMRSHKTFAALASLALVIGLGQVPIAQAQTEYRTASDG
FT                   SLNWGFRQSFRNYIQTGVAKGSITLGDGASDNGGNFAFTPRTNGTTVTSDSQGTVEFNG
FT                   SVHFLGHQADDKWILDTTMSDIKMVFNGSSAQLVVDLVAREFKGTTYDDIGEYIISDDI
FT                   VLADVSLNSAADFSQDSIDLSGTTTLTAAGAQAFGGFYETGDALDPTGGSLTISSTTTA
FT                   PSTSTTSTSASTSGGTADCSSGALGVVTTGTNDGMLGTIQEVNNTFAIWNNLIVNTERM
FT                   FCNIDTLKARFDTDNSSDSVTTATSGTTASTGTTAATTAGTTGTTGTASTASGTPGTSG
FT                   TAATVAGTTPTDNGVCTASGSLGVTQASAQWGVKASFQNYIRGSIANGSWTLNGVGFDN
FT                   QQFQFSGNSGAVDAENKTGSINFPGSIHFTGHGGILDMQIANIEISFNGNSGELIADVV
FT                   SSDMEGNSTNYGRTVVGTLNFSALNVSATEASGSASVSLSQSGSQAFADFYTPGTQLDP
FT                   ISFSATLGGDASCATESTSTTGAAATANTDNTEGVAGEESTTPANQNSQFQIRQAAADS
FT                   TGLDTTTTLLLILAAFVVAGGSMTRFTVGNPTGK"
     MKLAPRMRMR SHKTFAALAS LALVIGLGQV PIAQAQTEYR TASDGSLNWG FRQSFRNYIQ        60
     TGVAKGSITL GDGASDNGGN FAFTPRTNGT TVTSDSQGTV EFNGSVHFLG HQADDKWILD       120
     TTMSDIKMVF NGSSAQLVVD LVAREFKGTT YDDIGEYIIS DDIVLADVSL NSAADFSQDS       180
     IDLSGTTTLT AAGAQAFGGF YETGDALDPT GGSLTISSTT TAPSTSTTST SASTSGGTAD       240
     CSSGALGVVT TGTNDGMLGT IQEVNNTFAI WNNLIVNTER MFCNIDTLKA RFDTDNSSDS       300
     VTTATSGTTA STGTTAATTA GTTGTTGTAS TASGTPGTSG TAATVAGTTP TDNGVCTASG       360
     SLGVTQASAQ WGVKASFQNY IRGSIANGSW TLNGVGFDNQ QFQFSGNSGA VDAENKTGSI       420
     NFPGSIHFTG HGGILDMQIA NIEISFNGNS GELIADVVSS DMEGNSTNYG RTVVGTLNFS       480
     ALNVSATEAS GSASVSLSQS GSQAFADFYT PGTQLDPISF SATLGGDASC ATESTSTTGA       540
     AATANTDNTE GVAGEESTTP ANQNSQFQIR QAAADSTGLD TTTTLLLILA AFVVAGGSMT       600
     RFTVGNPTGK                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page