(data stored in ACNUC30630 zone)

EMBL: AP009044.PE490

AP009044.PE490       Location/Qualifiers
FT   CDS             520730..521662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53429"
FT                   /db_xref="GOA:A4QB32"
FT                   /db_xref="InterPro:IPR007331"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB32"
FT                   /protein_id="BAF53429.1"
FT                   /translation="MNKLATRALVALTGSAIAMTGLAVVSANAAEETGECRVTTTGTAD
FT                   WALKTSFNSYLEGPIANGTAYKYKGGIEVRDGVETSGERTTRQFTWPVEGSEEGTVNLG
FT                   GGVHWTGHNHYDGDDESQVAGNFLLDLDFSNPAVKFDGNKGTLLVDFKSREFVDFTNAG
FT                   EFLTGTQAELAKITFDAPIDLNKESVTVTGQTILSELGVGVMGNFYGAGDELAPITLNL
FT                   TNEVVCEDPGTPVEPETPVDPETPVDPETPVDSEEPGDDTDGNKDDNASNSSGNGDILG
FT                   ILGTLAALGGVGALVYNFLVASGFLAAFK"
     MNKLATRALV ALTGSAIAMT GLAVVSANAA EETGECRVTT TGTADWALKT SFNSYLEGPI        60
     ANGTAYKYKG GIEVRDGVET SGERTTRQFT WPVEGSEEGT VNLGGGVHWT GHNHYDGDDE       120
     SQVAGNFLLD LDFSNPAVKF DGNKGTLLVD FKSREFVDFT NAGEFLTGTQ AELAKITFDA       180
     PIDLNKESVT VTGQTILSEL GVGVMGNFYG AGDELAPITL NLTNEVVCED PGTPVEPETP       240
     VDPETPVDPE TPVDSEEPGD DTDGNKDDNA SNSSGNGDIL GILGTLAALG GVGALVYNFL       300
     VASGFLAAFK                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page