(data stored in ACNUC30630 zone)

EMBL: AP009044.PE491

AP009044.PE491       Location/Qualifiers
FT   CDS             521663..522535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53430"
FT                   /db_xref="GOA:A4QB33"
FT                   /db_xref="InterPro:IPR007331"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB33"
FT                   /protein_id="BAF53430.1"
FT                   /translation="MTRLSSALLAASVAGAALATPATTAHAAESVCTFTGDVGWNVRDS
FT                   FNSYLLGNIANGSAYKHKGGLDVRDGVQTDGNGRTPALTWPVDSVTSSKISTSGGAHWT
FT                   GHNLYTGDDLAEVPNNFTLDLDFSNITMELNGSTGRLLVDYTSREYIDTHTLGEFQSGE
FT                   QAELATITFAQAPDLSSNSVNVTGDVALTADGVEVFGGFYTAGEELAPITLNLTADEGC
FT                   GSTPEPEDTEDPETPSTSSSDFSLGSSPDVSSSSFGDTVTQVLSIGSMVGMAGLLFTIV
FT                   NYFIQSFAP"
     MTRLSSALLA ASVAGAALAT PATTAHAAES VCTFTGDVGW NVRDSFNSYL LGNIANGSAY        60
     KHKGGLDVRD GVQTDGNGRT PALTWPVDSV TSSKISTSGG AHWTGHNLYT GDDLAEVPNN       120
     FTLDLDFSNI TMELNGSTGR LLVDYTSREY IDTHTLGEFQ SGEQAELATI TFAQAPDLSS       180
     NSVNVTGDVA LTADGVEVFG GFYTAGEELA PITLNLTADE GCGSTPEPED TEDPETPSTS       240
     SSDFSLGSSP DVSSSSFGDT VTQVLSIGSM VGMAGLLFTI VNYFIQSFAP                  290
//

If you have problems or comments...

PBIL Back to PBIL home page