(data stored in ACNUC30630 zone)

EMBL: AP009044.PE53

AP009044.PE53        Location/Qualifiers
FT   CDS             complement(58879..59034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53013"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X0"
FT                   /protein_id="BAF53013.1"
FT                   /translation="MSMKSFQTLAQQAKQSWSDDTVAVDDAAASPYAADSNTRVHLGRT
FT                   LAEAHT"
     MSMKSFQTLA QQAKQSWSDD TVAVDDAAAS PYAADSNTRV HLGRTLAEAH T                 51
//

If you have problems or comments...

PBIL Back to PBIL home page