(data stored in ACNUC30630 zone)

EMBL: AP009044.PE55

AP009044.PE55        Location/Qualifiers
FT   CDS             complement(59595..59867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53014"
FT                   /db_xref="GOA:A4Q9X1"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Q9X1"
FT                   /protein_id="BAF53014.1"
FT                   /translation="MPKARVTKNETAPVSSNPSANRTPVKINSAGTPMWYKVIMFAFMI
FT                   VGLAWLIVNYLVGPQIPFMADLGAWNYGIGFGLMIIGLLMTMGWR"
     MPKARVTKNE TAPVSSNPSA NRTPVKINSA GTPMWYKVIM FAFMIVGLAW LIVNYLVGPQ        60
     IPFMADLGAW NYGIGFGLMI IGLLMTMGWR                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page