(data stored in ACNUC30630 zone)

EMBL: AP009044.PE556

AP009044.PE556       Location/Qualifiers
FT   CDS             complement(585996..586946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53494"
FT                   /db_xref="GOA:A4QB97"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB97"
FT                   /protein_id="BAF53494.1"
FT                   /translation="MARFSPQDLADHLKDGLLSFPATAFQDDLEVDEVAYVEHIEWQSS
FT                   YPVAGLFAAGGTGEGFSLTVEENHRVTQLAVQASSPEVPVLGSATGSTKSAIANAQGAE
FT                   AAGAEGVLLLPPYLTECDAEGLYNHAAAVCESTSLGVIVYNRANAIYSPEVIARLSERY
FT                   PNFIGFKDGTGNIEHLAKITTLCGDRLFYLGGLPTAETFALPLLQMGMSTYSSAMFNFI
FT                   PDFALSFYADVRAQDSAAVKQKLSDFVLPYLDIRDRAQGYGVSIVKGGLKAVGRNAGGV
FT                   RPPLRNLSEQDIADLSDLLATSGAGSYRLPVEVKA"
     MARFSPQDLA DHLKDGLLSF PATAFQDDLE VDEVAYVEHI EWQSSYPVAG LFAAGGTGEG        60
     FSLTVEENHR VTQLAVQASS PEVPVLGSAT GSTKSAIANA QGAEAAGAEG VLLLPPYLTE       120
     CDAEGLYNHA AAVCESTSLG VIVYNRANAI YSPEVIARLS ERYPNFIGFK DGTGNIEHLA       180
     KITTLCGDRL FYLGGLPTAE TFALPLLQMG MSTYSSAMFN FIPDFALSFY ADVRAQDSAA       240
     VKQKLSDFVL PYLDIRDRAQ GYGVSIVKGG LKAVGRNAGG VRPPLRNLSE QDIADLSDLL       300
     ATSGAGSYRL PVEVKA                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page