(data stored in ACNUC30630 zone)

EMBL: AP009044.PE57

AP009044.PE57        Location/Qualifiers
FT   CDS             complement(61929..63338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53016"
FT                   /db_xref="GOA:A4Q9X3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X3"
FT                   /protein_id="BAF53016.1"
FT                   /translation="MSQEDITGKDRLQELIGADYRLQWIIGHGGMSTVWLADDVVNDRE
FT                   VAIKVLRPEFSDNQEFLSRFRNEAQAAENIDSEHVVATYDYREVPDPAGHTFCFIVMEF
FT                   VRGESLADLLEREGSLPEDLALDVMEQAAHGLSVIHRMNMVHRDIKPGNMLITANGIVK
FT                   ITDFGIAKAAAAVPLTRTGMVVGTAQYVSPEQAQGKEVTAASDIYSLGVVGYEMMAGRR
FT                   PFTGDSSVSVAIAHINQAPPQMPTSISAQTRELIGIALRKDPGRRFPDGNEMALAVSAV
FT                   RLGKRPPQPRTSAMMAQAEAPSPSESTAMLGRVARPATITQEAAPKRGSGIGIGLFIAA
FT                   LLAVIIGAVIYAGTTGILFNDTPEETTTPETITETYTPTVEETTSQWVPPTPPTRSTFT
FT                   EPETTSHRPTTSEESTSAEPTTEAPTSSRTVPQIPTSTPRTSASVPVETNAPADDLIDA
FT                   VNGLLDVGGAQ"
     MSQEDITGKD RLQELIGADY RLQWIIGHGG MSTVWLADDV VNDREVAIKV LRPEFSDNQE        60
     FLSRFRNEAQ AAENIDSEHV VATYDYREVP DPAGHTFCFI VMEFVRGESL ADLLEREGSL       120
     PEDLALDVME QAAHGLSVIH RMNMVHRDIK PGNMLITANG IVKITDFGIA KAAAAVPLTR       180
     TGMVVGTAQY VSPEQAQGKE VTAASDIYSL GVVGYEMMAG RRPFTGDSSV SVAIAHINQA       240
     PPQMPTSISA QTRELIGIAL RKDPGRRFPD GNEMALAVSA VRLGKRPPQP RTSAMMAQAE       300
     APSPSESTAM LGRVARPATI TQEAAPKRGS GIGIGLFIAA LLAVIIGAVI YAGTTGILFN       360
     DTPEETTTPE TITETYTPTV EETTSQWVPP TPPTRSTFTE PETTSHRPTT SEESTSAEPT       420
     TEAPTSSRTV PQIPTSTPRT SASVPVETNA PADDLIDAVN GLLDVGGAQ                   469
//

If you have problems or comments...

PBIL Back to PBIL home page