(data stored in ACNUC30630 zone)

EMBL: AP009044.PE578

AP009044.PE578       Location/Qualifiers
FT   CDS             603605..603769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6028"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR91"
FT                   /protein_id="BAQ21090.1"
FT                   /translation="MPVDHTTILTAGYRNTPLSWTSTLGGTGQVPDWQASSWRVDETYI
FT                   RVGDRWCYL"
     MPVDHTTILT AGYRNTPLSW TSTLGGTGQV PDWQASSWRV DETYIRVGDR WCYL              54
//

If you have problems or comments...

PBIL Back to PBIL home page