(data stored in ACNUC30630 zone)

EMBL: AP009044.PE58

AP009044.PE58        Location/Qualifiers
FT   CDS             complement(63342..64766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53017"
FT                   /db_xref="GOA:A4Q9X4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X4"
FT                   /protein_id="BAF53017.1"
FT                   /translation="MNRSIRITSLFSLLLILVLVANLTWIQAFRDDDLAQNPLNARGFF
FT                   AAKSTPRGQISTGGQVLAESSQDNQGYYQRSYITNPTTYAPVVGYFSDVYGAAGLELGY
FT                   NSILNGSDSSLFTTQWLDVISGRPTHGANIELTLDPNAQQTAYEQLSQSGYEGAVVALR
FT                   PSTGEVLAMASSPSFDPNQIVNPATAEDAWAEYTSAEGAPLLNHATQESLPPGSIFKII
FT                   TTAAALENGYSADSTVTAEAAVTLPGTNTTLTNYGGQTCAGGGTTTLLTAFQLSCNTAF
FT                   VETGIDVGADALRASAEDFGVGQTYSLGLDNVPGGLGEIPDDAALGQSSIGQRDVQMNV
FT                   LQAAVMAGTVSNGGVRMEPYLVSRVTGQDLSELSTHKPKSVGGVEPEIAEQLKTLMEAS
FT                   ERNTSGYAGIQIASKTGTAEHGDENTPPHTWYVAFNNDIAVAVLVKDGGGFGTSATGGQ
FT                   VAAPIGRAVLQAAGGF"
     MNRSIRITSL FSLLLILVLV ANLTWIQAFR DDDLAQNPLN ARGFFAAKST PRGQISTGGQ        60
     VLAESSQDNQ GYYQRSYITN PTTYAPVVGY FSDVYGAAGL ELGYNSILNG SDSSLFTTQW       120
     LDVISGRPTH GANIELTLDP NAQQTAYEQL SQSGYEGAVV ALRPSTGEVL AMASSPSFDP       180
     NQIVNPATAE DAWAEYTSAE GAPLLNHATQ ESLPPGSIFK IITTAAALEN GYSADSTVTA       240
     EAAVTLPGTN TTLTNYGGQT CAGGGTTTLL TAFQLSCNTA FVETGIDVGA DALRASAEDF       300
     GVGQTYSLGL DNVPGGLGEI PDDAALGQSS IGQRDVQMNV LQAAVMAGTV SNGGVRMEPY       360
     LVSRVTGQDL SELSTHKPKS VGGVEPEIAE QLKTLMEASE RNTSGYAGIQ IASKTGTAEH       420
     GDENTPPHTW YVAFNNDIAV AVLVKDGGGF GTSATGGQVA APIGRAVLQA AGGF             474
//

If you have problems or comments...

PBIL Back to PBIL home page