(data stored in ACNUC30630 zone)

EMBL: AP009044.PE590

AP009044.PE590       Location/Qualifiers
FT   CDS             613806..613955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53522"
FT                   /db_xref="GOA:A4QBC5"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC5"
FT                   /protein_id="BAF53522.1"
FT                   /translation="MLGMTFFLDFIVAPLVQVVTIVLGGWLLDPTGVRTSWKDFLGGGS
FT                   PELT"
     MLGMTFFLDF IVAPLVQVVT IVLGGWLLDP TGVRTSWKDF LGGGSPELT                    49
//

If you have problems or comments...

PBIL Back to PBIL home page