(data stored in ACNUC30630 zone)

EMBL: AP009044.PE604

AP009044.PE604       Location/Qualifiers
FT   CDS             complement(622195..623559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53532"
FT                   /db_xref="GOA:A4QBD5"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD5"
FT                   /protein_id="BAF53532.1"
FT                   /translation="MRTENRRQCHNGVVKKNDHGTTGTSESFRIRGSIPDIPRETRWDR
FT                   LWRPFWAIPAASVVAALVFGFLLPTWERGLSDAALKFVFEGGPDAAREVLGTIAASTIS
FT                   VTGLIFSITLVVLQLVSSQFSPRMLNGFLRNRIVQATLAMFLGTFVFSLTVIRYVWSED
FT                   EDITGFVPRASVSVAFLLVLGCLGLFLAFIRLITFSMRVANAISEIGEETMALAARIYP
FT                   VQSDDAGPVQGPGWSPRPGDPREEIRVGSHGSLVWIDYRKLVSWSTEHQAVITVDRPVG
FT                   DFLVEGQPLLRVWWDGELSDRDRRVLHSAIEVRTERELHQDVAFGLRQLVDIADRALSP
FT                   GINDPATAAQCVQEIHRIFRYLVTVIEPSPYIADDDGRVRVVHQPQRIADMLYEVIREI
FT                   HLYGADSAMIPRLLRTMVEDLVTAAADHSLPAVERARGILDDETDEDRDSDTANV"
     MRTENRRQCH NGVVKKNDHG TTGTSESFRI RGSIPDIPRE TRWDRLWRPF WAIPAASVVA        60
     ALVFGFLLPT WERGLSDAAL KFVFEGGPDA AREVLGTIAA STISVTGLIF SITLVVLQLV       120
     SSQFSPRMLN GFLRNRIVQA TLAMFLGTFV FSLTVIRYVW SEDEDITGFV PRASVSVAFL       180
     LVLGCLGLFL AFIRLITFSM RVANAISEIG EETMALAARI YPVQSDDAGP VQGPGWSPRP       240
     GDPREEIRVG SHGSLVWIDY RKLVSWSTEH QAVITVDRPV GDFLVEGQPL LRVWWDGELS       300
     DRDRRVLHSA IEVRTERELH QDVAFGLRQL VDIADRALSP GINDPATAAQ CVQEIHRIFR       360
     YLVTVIEPSP YIADDDGRVR VVHQPQRIAD MLYEVIREIH LYGADSAMIP RLLRTMVEDL       420
     VTAAADHSLP AVERARGILD DETDEDRDSD TANV                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page