(data stored in ACNUC30630 zone)

EMBL: AP009044.PE615

AP009044.PE615       Location/Qualifiers
FT   CDS             complement(633103..634557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53543"
FT                   /db_xref="GOA:A4QBE6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBE6"
FT                   /protein_id="BAF53543.1"
FT                   /translation="MGTGWNGSAATHSSLPLVIECGFILSVNPVKWTKSFLFNRSRRKA
FT                   LEAPWVSLLALRTETMGFVSTTFDVLIIGAGPSGASAAVHAARAGLQTLLIDASSFPRD
FT                   KTCGDGLTPRAIHQLELLGVADQVTGDYFNKGLKLHGFGGSVEAPWPETYFTNKGSAMS
FT                   RMEFDDLLFRLAKSHEEVTTWENASAQDPILRGNFLEGVVINHAGQEKTVKAKHVIIAD
FT                   GVRSPFGKKLGRQWHRDEVYGIAARAYCETPLSDEPWIHSHVELRDEDGVVQPGYGWIF
FT                   PLGNGTVNLGCGALSTDKRPAKINTKKLLSFYAGQRRKAWQLGPEHDVASALLPMGGAV
FT                   SNVAGANWMLIGDSAACVNPLNGEGIDYGLETAAMAVDTLVENPKRDLTLVWPHRLRDA
FT                   YGETFMLARTAARLLTYPQFLPMAGPLAFRGPLQKAIMPAAARLMGNLITEEDKDLLAR
FT                   GWQAAGSAISWARKGSPLWDSTSSLV"
     MGTGWNGSAA THSSLPLVIE CGFILSVNPV KWTKSFLFNR SRRKALEAPW VSLLALRTET        60
     MGFVSTTFDV LIIGAGPSGA SAAVHAARAG LQTLLIDASS FPRDKTCGDG LTPRAIHQLE       120
     LLGVADQVTG DYFNKGLKLH GFGGSVEAPW PETYFTNKGS AMSRMEFDDL LFRLAKSHEE       180
     VTTWENASAQ DPILRGNFLE GVVINHAGQE KTVKAKHVII ADGVRSPFGK KLGRQWHRDE       240
     VYGIAARAYC ETPLSDEPWI HSHVELRDED GVVQPGYGWI FPLGNGTVNL GCGALSTDKR       300
     PAKINTKKLL SFYAGQRRKA WQLGPEHDVA SALLPMGGAV SNVAGANWML IGDSAACVNP       360
     LNGEGIDYGL ETAAMAVDTL VENPKRDLTL VWPHRLRDAY GETFMLARTA ARLLTYPQFL       420
     PMAGPLAFRG PLQKAIMPAA ARLMGNLITE EDKDLLARGW QAAGSAISWA RKGSPLWDST       480
     SSLV                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page