(data stored in ACNUC30630 zone)

EMBL: AP009044.PE625

AP009044.PE625       Location/Qualifiers
FT   CDS             644769..646016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53552"
FT                   /db_xref="GOA:A4QBF5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBF5"
FT                   /protein_id="BAF53552.1"
FT                   /translation="MTTESIVGHNAAGTAPQNVSSAKKKYLSVAQGVALIYGTNIGAGV
FT                   LSLPYAARNGGFLALVVALLIAGTLTTISMLYIAEVSLRTKKPLQLSGLAEKYLGQWGR
FT                   WLVFIAIVVNSVGALIAYASGSGILIGNLTGLPPIVGTLGFFVLGTLIMWKGLHTASFV
FT                   EALITTGMATIIIVLCGWTVLGPGISADNLIVFHPFFIVPIMNLAVFTFLAQYVVPEIA
FT                   RGVNPATPKAVPRAIIIGMVATGVTLAAVPFAALGLLGTGVSEVVTISWGEALAPVAYY
FT                   MANAFALLAMFTSFIAIGFTAMRNVLDIGHWPEHGWQRSVAVGLTVLPPLAISLAGLGG
FT                   FVAALSYAGGFAGAIMSIIPVLLLRNSRKRGDQEPVWKATWQAHPIFQILLIVVYSLAF
FT                   VYSVLAIVGLMPAGWA"
     MTTESIVGHN AAGTAPQNVS SAKKKYLSVA QGVALIYGTN IGAGVLSLPY AARNGGFLAL        60
     VVALLIAGTL TTISMLYIAE VSLRTKKPLQ LSGLAEKYLG QWGRWLVFIA IVVNSVGALI       120
     AYASGSGILI GNLTGLPPIV GTLGFFVLGT LIMWKGLHTA SFVEALITTG MATIIIVLCG       180
     WTVLGPGISA DNLIVFHPFF IVPIMNLAVF TFLAQYVVPE IARGVNPATP KAVPRAIIIG       240
     MVATGVTLAA VPFAALGLLG TGVSEVVTIS WGEALAPVAY YMANAFALLA MFTSFIAIGF       300
     TAMRNVLDIG HWPEHGWQRS VAVGLTVLPP LAISLAGLGG FVAALSYAGG FAGAIMSIIP       360
     VLLLRNSRKR GDQEPVWKAT WQAHPIFQIL LIVVYSLAFV YSVLAIVGLM PAGWA            415
//

If you have problems or comments...

PBIL Back to PBIL home page