(data stored in ACNUC30630 zone)

EMBL: AP009044.PE626

AP009044.PE626       Location/Qualifiers
FT   CDS             646142..648094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53553"
FT                   /db_xref="GOA:A4QBF6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBF6"
FT                   /protein_id="BAF53553.1"
FT                   /translation="MLVSDIFMGDNGVMNKKLNTPNPWMLFIRSFDGIITVAALVAIAI
FT                   HLILWLALDLDGLAKNWPLIAIVILGGIPLMWDVLKSAIKTRGGADTLAAVSIITSVLL
FT                   GEWLVAAIIVLMLSGGEALEEAASRRASGTLDALARRAPSTAHRLLGATILDGTEEIAV
FT                   EEITVGDLVAVLPHELCPVDGEIVAGHGTMDESYLTGEPYVVSKSKGSQAMSGAVNGDT
FT                   PLTIVATKLAHDSRYAQIVGVLHEAENNRPEMRRMADRLGAWYTVIALALGGLGWIISG
FT                   DPVRFLAVVVVATPCPLLIAVPVAIIGAISLAARRGIIVKNPGMLENASEVKTVMFDKT
FT                   GTLTYGRPVITDIHTAPGVEEDTVLALAASVERYSRHPLADAIREGAKARELHLPDVVE
FT                   VSERPGQGLTGTVGEHLVRITNRRSTLEIDPDSKNYIPVTSSGMESVVLVDDKYAALIR
FT                   LRDEPRASASEFIAHLPKKHKVDKLMIISGDRASEVRYLADKVGIDEVHAEASPEDKLN
FT                   IVNRHNEHGATMFLGDGINDAPAMAVATVGVAMGADSDVTSEAADAVILDSSLERLDDL
FT                   LHISARMRRIALQSAGGGMALSVVGMILAVFGFLTPLMGAIFQEVIDVLAILNSARVAV
FT                   PRGAISDFDTQEKVS"
     MLVSDIFMGD NGVMNKKLNT PNPWMLFIRS FDGIITVAAL VAIAIHLILW LALDLDGLAK        60
     NWPLIAIVIL GGIPLMWDVL KSAIKTRGGA DTLAAVSIIT SVLLGEWLVA AIIVLMLSGG       120
     EALEEAASRR ASGTLDALAR RAPSTAHRLL GATILDGTEE IAVEEITVGD LVAVLPHELC       180
     PVDGEIVAGH GTMDESYLTG EPYVVSKSKG SQAMSGAVNG DTPLTIVATK LAHDSRYAQI       240
     VGVLHEAENN RPEMRRMADR LGAWYTVIAL ALGGLGWIIS GDPVRFLAVV VVATPCPLLI       300
     AVPVAIIGAI SLAARRGIIV KNPGMLENAS EVKTVMFDKT GTLTYGRPVI TDIHTAPGVE       360
     EDTVLALAAS VERYSRHPLA DAIREGAKAR ELHLPDVVEV SERPGQGLTG TVGEHLVRIT       420
     NRRSTLEIDP DSKNYIPVTS SGMESVVLVD DKYAALIRLR DEPRASASEF IAHLPKKHKV       480
     DKLMIISGDR ASEVRYLADK VGIDEVHAEA SPEDKLNIVN RHNEHGATMF LGDGINDAPA       540
     MAVATVGVAM GADSDVTSEA ADAVILDSSL ERLDDLLHIS ARMRRIALQS AGGGMALSVV       600
     GMILAVFGFL TPLMGAIFQE VIDVLAILNS ARVAVPRGAI SDFDTQEKVS                  650
//

If you have problems or comments...

PBIL Back to PBIL home page