(data stored in ACNUC30630 zone)

EMBL: AP009044.PE635

AP009044.PE635       Location/Qualifiers
FT   CDS             661292..662074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53562"
FT                   /db_xref="GOA:A4QBG5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBG5"
FT                   /protein_id="BAF53562.1"
FT                   /translation="MDELLKQEVKDFLTTRRARITPAAAGIETQPWSDRRVPGLRREEV
FT                   ADLAGISLEYYIRFERGNLKGASPEILQSLAKALQLSPIEREHLHNLAYRADHPRNLPS
FT                   AETPTAPLQDIVDAVTDKPAWIRNEQMDILATNRLCAELYAPILKDLPDRPNTARHCFI
FT                   GATAEQFWMDRDQFSAEFAAKLRLEYARRPSAPGLKELIDELHQKSSVFRENWASADVL
FT                   SFGSGIKRFRHPTLGERVYEYETFNLNSAPGYVLSIYF"
     MDELLKQEVK DFLTTRRARI TPAAAGIETQ PWSDRRVPGL RREEVADLAG ISLEYYIRFE        60
     RGNLKGASPE ILQSLAKALQ LSPIEREHLH NLAYRADHPR NLPSAETPTA PLQDIVDAVT       120
     DKPAWIRNEQ MDILATNRLC AELYAPILKD LPDRPNTARH CFIGATAEQF WMDRDQFSAE       180
     FAAKLRLEYA RRPSAPGLKE LIDELHQKSS VFRENWASAD VLSFGSGIKR FRHPTLGERV       240
     YEYETFNLNS APGYVLSIYF                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page