(data stored in ACNUC30630 zone)

EMBL: AP009044.PE637

AP009044.PE637       Location/Qualifiers
FT   CDS             663122..663490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53564"
FT                   /db_xref="GOA:A4QBG7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBG7"
FT                   /protein_id="BAF53564.1"
FT                   /translation="MPTIQQLVRKGRHDKSAKVATAALKGSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTSGIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGALDT
FT                   QGVKDRKQARSRYGAKRG"
     MPTIQQLVRK GRHDKSAKVA TAALKGSPQR RGVCTRVYTT TPKKPNSALR KVARVRLTSG        60
     IEVSAYIPGE GHNLQEHSMV LVRGGRVKDL PGVRYKIVRG ALDTQGVKDR KQARSRYGAK       120
     RG                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page