(data stored in ACNUC30630 zone)

EMBL: AP009044.PE641

AP009044.PE641       Location/Qualifiers
FT   CDS             668467..669198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53568"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBH1"
FT                   /protein_id="BAF53568.1"
FT                   /translation="MKDPSRIPPVVAQLQKVWEAQPDLALPTLLGILGNRGIGWGSTDE
FT                   DLVEALNTMYTENPGEIRGGSRIADPQREVPGRFLVETESPAYRITVDPFRVSVRRIAK
FT                   GPHRPLQPGVWEFQEIRRCRSGEPLLITDVEGIDHRLGVVVRITLLNDSPAPKTKSLDK
FT                   VRRREVGDKVFYLHFESGDTALLNHGLEIYQASRRTLEQHSVKWDQLITATPGQLLKLK
FT                   ETGSGKILELGVLEKIIPLEG"
     MKDPSRIPPV VAQLQKVWEA QPDLALPTLL GILGNRGIGW GSTDEDLVEA LNTMYTENPG        60
     EIRGGSRIAD PQREVPGRFL VETESPAYRI TVDPFRVSVR RIAKGPHRPL QPGVWEFQEI       120
     RRCRSGEPLL ITDVEGIDHR LGVVVRITLL NDSPAPKTKS LDKVRRREVG DKVFYLHFES       180
     GDTALLNHGL EIYQASRRTL EQHSVKWDQL ITATPGQLLK LKETGSGKIL ELGVLEKIIP       240
     LEG                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page