(data stored in ACNUC30630 zone)

EMBL: AP009044.PE648

AP009044.PE648       Location/Qualifiers
FT   CDS             complement(676060..676533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53575"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBH8"
FT                   /protein_id="BAF53575.1"
FT                   /translation="MCSLVTVAGTLASEAMALHSAGVALTLGGTGDVNELDVVEDFNGN
FT                   VLSNLVTGDIVHTNLGDVAAGGNACFLEVTSQWLVHLAWVDFAVGDLDGVVAIGLNGAN
FT                   LGNYAWTRFNDGNRNNAVLLVEDLSHAELGAQNALDLVFTHYLFSAAKNSVDH"
     MCSLVTVAGT LASEAMALHS AGVALTLGGT GDVNELDVVE DFNGNVLSNL VTGDIVHTNL        60
     GDVAAGGNAC FLEVTSQWLV HLAWVDFAVG DLDGVVAIGL NGANLGNYAW TRFNDGNRNN       120
     AVLLVEDLSH AELGAQNALD LVFTHYLFSA AKNSVDH                                157
//

If you have problems or comments...

PBIL Back to PBIL home page