(data stored in ACNUC30630 zone)

EMBL: AP009044.PE657

AP009044.PE657       Location/Qualifiers
FT   CDS             679241..679987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53584"
FT                   /db_xref="GOA:A4QBI7"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBI7"
FT                   /protein_id="BAF53584.1"
FT                   /translation="MGQKIHPHGLRLGITSDWKSHWYADKSYADYVAEDIKIREFLSKG
FT                   LDRAGIADVVIERTRDRVRVDIHTARPGIVIGRRGAEADRIRRELEKLTGKQVALNILE
FT                   VKNVDANAKLVAQSIAEQLTNRVAFRRAMRKAIQSAMRQPQVKGIKVVCSGRLGGAEMS
FT                   RTERYHEGRVPLHTLRAEIDYGTYEAHTTFGRIGVKVWIYKGDVVGGRRESEINAPAER
FT                   RGRGDRNARPRRGGQRRQRAEQKQEG"
     MGQKIHPHGL RLGITSDWKS HWYADKSYAD YVAEDIKIRE FLSKGLDRAG IADVVIERTR        60
     DRVRVDIHTA RPGIVIGRRG AEADRIRREL EKLTGKQVAL NILEVKNVDA NAKLVAQSIA       120
     EQLTNRVAFR RAMRKAIQSA MRQPQVKGIK VVCSGRLGGA EMSRTERYHE GRVPLHTLRA       180
     EIDYGTYEAH TTFGRIGVKV WIYKGDVVGG RRESEINAPA ERRGRGDRNA RPRRGGQRRQ       240
     RAEQKQEG                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page