(data stored in ACNUC30630 zone)

EMBL: AP009044.PE659

AP009044.PE659       Location/Qualifiers
FT   CDS             680406..680636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53586"
FT                   /db_xref="GOA:A4QBI9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBI9"
FT                   /protein_id="BAF53586.1"
FT                   /translation="MAIGTPAHEFRELNEEELVTRLNEAKEELFNLRFQLATGQLTNNR
FT                   RLRTVKRDIARIYTVIRERELGLSVVPGAEA"
     MAIGTPAHEF RELNEEELVT RLNEAKEELF NLRFQLATGQ LTNNRRLRTV KRDIARIYTV        60
     IRERELGLSV VPGAEA                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page