(data stored in ACNUC30630 zone)

EMBL: AP009044.PE661

AP009044.PE661       Location/Qualifiers
FT   CDS             680639..680917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53588"
FT                   /db_xref="GOA:A4QBJ1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBJ1"
FT                   /protein_id="BAF53588.1"
FT                   /translation="MSEANVNNQEKSTRKVRTGYVVSDKMQKTIVVEVEDRKQHALYGK
FT                   ILRSAKKVKAHDEEQIAGIGDLVRIEETRPLSKDKNYRLIEIVEKAK"
     MSEANVNNQE KSTRKVRTGY VVSDKMQKTI VVEVEDRKQH ALYGKILRSA KKVKAHDEEQ        60
     IAGIGDLVRI EETRPLSKDK NYRLIEIVEK AK                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page