(data stored in ACNUC30630 zone)

EMBL: AP009044.PE679

AP009044.PE679       Location/Qualifiers
FT   CDS             complement(697117..697587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53606"
FT                   /db_xref="GOA:A4QBK9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK9"
FT                   /protein_id="BAF53606.1"
FT                   /translation="MEEFGTDPIHGSGYFENYLPIDFSEAGFHHYLKERTDAADPSVPP
FT                   PEGFVHCSYFWIVDDDDVLVGFLALRHELNQHLLEVAGHIGYGVRPSARRKGAATAALK
FT                   LGIHEAQALGIDKVLLCVAGDNEASRNVIEKCGGVYESTIRGMRRYWIATDS"
     MEEFGTDPIH GSGYFENYLP IDFSEAGFHH YLKERTDAAD PSVPPPEGFV HCSYFWIVDD        60
     DDVLVGFLAL RHELNQHLLE VAGHIGYGVR PSARRKGAAT AALKLGIHEA QALGIDKVLL       120
     CVAGDNEASR NVIEKCGGVY ESTIRGMRRY WIATDS                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page