(data stored in ACNUC30630 zone)

EMBL: AP009044.PE680

AP009044.PE680       Location/Qualifiers
FT   CDS             697998..698396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53607"
FT                   /db_xref="GOA:A4QBL0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBL0"
FT                   /protein_id="BAF53607.1"
FT                   /translation="MTMTDPIADMLSRVRNASNAHHDTVSMPSSKIKANIAEILKQEGY
FT                   IANYTVEDAKVGKTLSLELKYSNTRERSIAGLRRVSKPGLRVYAKSTNLPQVLGGLGVA
FT                   IISTSQGLLTDRQATEKGVGGEVLAYVW"
     MTMTDPIADM LSRVRNASNA HHDTVSMPSS KIKANIAEIL KQEGYIANYT VEDAKVGKTL        60
     SLELKYSNTR ERSIAGLRRV SKPGLRVYAK STNLPQVLGG LGVAIISTSQ GLLTDRQATE       120
     KGVGGEVLAY VW                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page