(data stored in ACNUC30630 zone)

EMBL: AP009044.PE682

AP009044.PE682       Location/Qualifiers
FT   CDS             698956..699360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53609"
FT                   /db_xref="GOA:A4QBL2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBL2"
FT                   /protein_id="BAF53609.1"
FT                   /translation="MSNTENKQKRVSVGKDIATRRRVARARRHFRIRKNLRGTPEAPRL
FT                   VVHRSSRHMHVQIIDDVAGHTLAAASSIEAEVRATEGDKKAKGAKVGQLIAERAKAAGI
FT                   EQVVFDRAGYKYHGRVAALADAAREGGLKF"
     MSNTENKQKR VSVGKDIATR RRVARARRHF RIRKNLRGTP EAPRLVVHRS SRHMHVQIID        60
     DVAGHTLAAA SSIEAEVRAT EGDKKAKGAK VGQLIAERAK AAGIEQVVFD RAGYKYHGRV       120
     AALADAAREG GLKF                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page