(data stored in ACNUC30630 zone)

EMBL: AP009044.PE683

AP009044.PE683       Location/Qualifiers
FT   CDS             699401..700036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53610"
FT                   /db_xref="GOA:A4QBL3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBL3"
FT                   /protein_id="BAF53610.1"
FT                   /translation="MPGRERRDGGRSADDNKQNDRNERRGGGRRDDRRNQQQDERSQYI
FT                   ERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQKGAEEARKNF
FT                   FRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIAGGAARPVLECAGIQDILSKSLGS
FT                   DNAINVVHATVDGLKQLVRPEEVAARRGKTIEEVAPARILRARAGQEA"
     MPGRERRDGG RSADDNKQND RNERRGGGRR DDRRNQQQDE RSQYIERVVT INRVSKVVKG        60
     GRRFSFTALV IVGDGKGMVG VGYGKAKEVP AAIQKGAEEA RKNFFRVPMV NGTITHPVQG       120
     EKAAGIVMLK PAAPGTGVIA GGAARPVLEC AGIQDILSKS LGSDNAINVV HATVDGLKQL       180
     VRPEEVAARR GKTIEEVAPA RILRARAGQE A                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page