(data stored in ACNUC30630 zone)

EMBL: AP009044.PE698

AP009044.PE698       Location/Qualifiers
FT   CDS             711655..712404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53625"
FT                   /db_xref="GOA:A4QBM8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM8"
FT                   /protein_id="BAF53625.1"
FT                   /translation="MSFDFDALTITESDDLLIIELSRPEVRNAIDQTMVNELHEVCAYL
FT                   EENPKTAIIIGSDGIFASGADIGQLRERRREDALRGINNSIFHRIAQLPMPVIAAVDGF
FT                   ALGGGLELALAADFRVATQNAKFGQPEASLGIMAAAGGTWRLKAAVGEPLAKDILLAGR
FT                   IIDGEEAKTYQLVSNLAPAEDLLDEAKKLAQRIGKLDPLAVRITKSVMALPESAHPQAD
FT                   NLAQAILFESEAKFDRMQAFLDRKKSK"
     MSFDFDALTI TESDDLLIIE LSRPEVRNAI DQTMVNELHE VCAYLEENPK TAIIIGSDGI        60
     FASGADIGQL RERRREDALR GINNSIFHRI AQLPMPVIAA VDGFALGGGL ELALAADFRV       120
     ATQNAKFGQP EASLGIMAAA GGTWRLKAAV GEPLAKDILL AGRIIDGEEA KTYQLVSNLA       180
     PAEDLLDEAK KLAQRIGKLD PLAVRITKSV MALPESAHPQ ADNLAQAILF ESEAKFDRMQ       240
     AFLDRKKSK                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page