(data stored in ACNUC30630 zone)

EMBL: AP009044.PE7

AP009044.PE7         Location/Qualifiers
FT   CDS             7830..8798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52968"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S5"
FT                   /protein_id="BAF52968.1"
FT                   /translation="MIQTYILKIQSLKRAQREMLKTTLITDTLGHVTSTEPTTTAHVPL
FT                   PDGSSTPVQIWASDNKDSQLVMLWPGFGMGGYYYRPIAAALNKAGFHVAIGELRGQGQS
FT                   SAKSSRKNQWGYHDLASVDFPLQIAAAKKALDLEEGHPMRFLSHSMGGQISCLFAARPE
FT                   AEKYNLRAIFGVGAGSPFRPTFSPKMGKRLGLGAVLLGGIGGHVVGFWPGKVLGKDLVG
FT                   YGRQSGTHMREWRRFHKHNSLDDLTAQDINYVEAMKKVSIPITFSRCPDDEDCPQASID
FT                   GLASFVPAAQIKMIEIPEALGHNRWAREPESTVKLFLEQAL"
     MIQTYILKIQ SLKRAQREML KTTLITDTLG HVTSTEPTTT AHVPLPDGSS TPVQIWASDN        60
     KDSQLVMLWP GFGMGGYYYR PIAAALNKAG FHVAIGELRG QGQSSAKSSR KNQWGYHDLA       120
     SVDFPLQIAA AKKALDLEEG HPMRFLSHSM GGQISCLFAA RPEAEKYNLR AIFGVGAGSP       180
     FRPTFSPKMG KRLGLGAVLL GGIGGHVVGF WPGKVLGKDL VGYGRQSGTH MREWRRFHKH       240
     NSLDDLTAQD INYVEAMKKV SIPITFSRCP DDEDCPQASI DGLASFVPAA QIKMIEIPEA       300
     LGHNRWAREP ESTVKLFLEQ AL                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page