(data stored in ACNUC30630 zone)

EMBL: AP009044.PE702

AP009044.PE702       Location/Qualifiers
FT   CDS             complement(715975..716340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53629"
FT                   /db_xref="GOA:A4QBN2"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN2"
FT                   /protein_id="BAF53629.1"
FT                   /translation="MQHPPVPGKSILAFYVVVLVALCLWFKIGSIPDIAVIGYILALSF
FT                   TSAIITAALTQKSPQWVLLTVGLVGLIIVGICIFLWITVPEGILNIAVLLVASGAVIAE
FT                   ISLLISRMRPRRRQATH"
     MQHPPVPGKS ILAFYVVVLV ALCLWFKIGS IPDIAVIGYI LALSFTSAII TAALTQKSPQ        60
     WVLLTVGLVG LIIVGICIFL WITVPEGILN IAVLLVASGA VIAEISLLIS RMRPRRRQAT       120
     H                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page