(data stored in ACNUC30630 zone)

EMBL: AP009044.PE713

AP009044.PE713       Location/Qualifiers
FT   CDS             complement(728129..728611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53640"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP3"
FT                   /protein_id="BAF53640.1"
FT                   /translation="MIDQRSSLIAVDTETGADGLFVVISATAGQHALHDDVFRNLVVNN
FT                   TIEGLASFGKQVSQDVSLLNGAWETIQKEAFCSIGLSKAGSNHTCSHVGWNQLASVDVL
FT                   LGLDTQRGTLANVGAEKIASRNVRNAKLLRENCSLGALTSTGRSEEYESHYFRSPS"
     MIDQRSSLIA VDTETGADGL FVVISATAGQ HALHDDVFRN LVVNNTIEGL ASFGKQVSQD        60
     VSLLNGAWET IQKEAFCSIG LSKAGSNHTC SHVGWNQLAS VDVLLGLDTQ RGTLANVGAE       120
     KIASRNVRNA KLLRENCSLG ALTSTGRSEE YESHYFRSPS                             160
//

If you have problems or comments...

PBIL Back to PBIL home page