(data stored in ACNUC30630 zone)

EMBL: AP009044.PE714

AP009044.PE714       Location/Qualifiers
FT   CDS             728150..728695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53641"
FT                   /db_xref="GOA:A4QBP4"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBP4"
FT                   /protein_id="BAF53641.1"
FT                   /translation="MRLVLLGPPGAGKGTQAAILSEKLGIPHISTGDLFRANIGEGTPL
FT                   GIEAKQYIDAGKLVPTDVTARMVASRLAESDAAEGFLLDGFPRTVEQADILANLLSEAG
FT                   QTLDGVVNYQVSEDVVVERMLSRGRADDNEETIRTRLGVYRDETAPLIDHYGDKIINIE
FT                   AEGEVEEINARTLKALGK"
     MRLVLLGPPG AGKGTQAAIL SEKLGIPHIS TGDLFRANIG EGTPLGIEAK QYIDAGKLVP        60
     TDVTARMVAS RLAESDAAEG FLLDGFPRTV EQADILANLL SEAGQTLDGV VNYQVSEDVV       120
     VERMLSRGRA DDNEETIRTR LGVYRDETAP LIDHYGDKII NIEAEGEVEE INARTLKALG       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page