(data stored in ACNUC30630 zone)

EMBL: AP009044.PE719

AP009044.PE719       Location/Qualifiers
FT   CDS             733242..734675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53646"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP9"
FT                   /protein_id="BAF53646.1"
FT                   /translation="MLIGNKPLVGELSLDSADAGDPSNPVHVTSERDFPGIEAEGPAGI
FT                   TIIDTSGVIVEDISVSVSHDHSEEATDGVLLHATEGSGMHSGITVQKVRVTGAYNGIAA
FT                   SSAGAGDGFDDVIIKDAIVQDCIRNGIITYGPTAPDYGHKNIRVLDSVVSGTKGISDIT
FT                   TNSGSGIVIGSVEDAVVERNEAFNNGALSNADEGPIGIWTHDSTRVLVRDNRSHDNSSQ
FT                   RSDGGGFGLDIATTNSTMERNYSYNNAGPGFLLIAHQGGGSSGANVVRYNASIGDSWLN
FT                   AYHGGISAIGGFSSSEDEPQIEDTKIHHNTVFPAPSSGAAALKLRGNLDGITVHHNILD
FT                   TSAGDAPSIAAIDVSADSKVNFIANQLAVNQFTRTPVFDWNGERAQTVEQAEALVQDSF
FT                   DNFEYAPIYPGGFEISTVLDTIAWTQPVSVPSLVPGDSTPATKDLAGNTVEEPNSYVGA
FT                   INPTFSDQNARRQRTFERR"
     MLIGNKPLVG ELSLDSADAG DPSNPVHVTS ERDFPGIEAE GPAGITIIDT SGVIVEDISV        60
     SVSHDHSEEA TDGVLLHATE GSGMHSGITV QKVRVTGAYN GIAASSAGAG DGFDDVIIKD       120
     AIVQDCIRNG IITYGPTAPD YGHKNIRVLD SVVSGTKGIS DITTNSGSGI VIGSVEDAVV       180
     ERNEAFNNGA LSNADEGPIG IWTHDSTRVL VRDNRSHDNS SQRSDGGGFG LDIATTNSTM       240
     ERNYSYNNAG PGFLLIAHQG GGSSGANVVR YNASIGDSWL NAYHGGISAI GGFSSSEDEP       300
     QIEDTKIHHN TVFPAPSSGA AALKLRGNLD GITVHHNILD TSAGDAPSIA AIDVSADSKV       360
     NFIANQLAVN QFTRTPVFDW NGERAQTVEQ AEALVQDSFD NFEYAPIYPG GFEISTVLDT       420
     IAWTQPVSVP SLVPGDSTPA TKDLAGNTVE EPNSYVGAIN PTFSDQNARR QRTFERR          477
//

If you have problems or comments...

PBIL Back to PBIL home page